Research use only. This compound is supplied for in-vitro laboratory research by qualified researchers. It is not for human or veterinary consumption and has not been evaluated by the FDA.

Cellular & Redox
FOXO4
Certificate pending · 10mg
10mg$170.00each
$17.00/mg
FOXO4-DRI is a forty-six-residue synthetic peptide built entirely from D-amino acids in reversed sequence order, fused to a cell-penetrating segment. It is not the protein whose name it borrows.
That distinction is the first thing to be clear about. FOXO4 is a human transcription factor of five hundred and five residues, UniProt P98177. The material sold at this scale is the retro-inverso peptide described by Baar and colleagues in Cell in 2017, which is a different molecule entirely; any specification carrying the transcription factor's residue count or mass is describing something that does not come in a vial.
Thirty-three of its residues correspond to residues 92 to 124 of P98177, spanning the disordered region into the first helix of the forkhead domain. The remaining thirteen are the HIV-1 Tat basic segment together with a proline triplet, which Baar and colleagues describe as included to carry the peptide across the membrane. Because the whole chain is reversed, that Tat segment sits at the C-terminal end of the peptide as written, not the N-terminal end - a frequent annotation error.
Retro-inversion is the design. Reversing the backbone while inverting the configuration at every alpha carbon leaves the side chains in approximately their original spatial arrangement while removing the chain as a substrate for proteases that recognise L-peptides. The mass of 5358.2 is the figure stated in the paper's methods section and it is for the free peptide with a free amine and a free acid; there is no acetylation, no amidation, no cysteine and no disulfide.
No CAS number and no molecular formula are printed here because none exists. This peptide is in the primary literature but has never been entered into a chemical registry: there is no PubChem compound record for the assembled forty-six-mer and no FDA UNII, so there is no identifier a buyer can match a certificate against.
One consequence of that follows directly and is worth saying rather than leaving implicit. The all-D peptide and the ordinary L-peptide of the same sequence have identical masses and are indistinguishable by mass spectrometry; separating them needs a chiral method such as amino-acid analysis with Marfey's reagent, optical rotation or circular dichroism. A certificate reporting mass and chromatographic purity alone does not establish that the material is the D-form.
The peptide has one tryptophan and one tyrosine, so absorbance at 280 nm is usable, and D-configuration does not change ultraviolet absorbance. Its characterised molecular partner is the disordered transactivation domain of p53 (UniProt P04637), measured by isothermal titration calorimetry and NMR in a 2025 Nature Communications study, where it competes with the interaction the parent protein makes.
Certificate pending for the 10mg lot.The signed report will be published here as soon as the laboratory returns it.
Ordering at volume or on a schedule?
Request a supply quote →Buy more of this strength and the price comes down. The store applies it at checkout - there is nothing to enter.
Free US shipping - no minimum
Tell us the lot number and what you observed. If independent testing shows a discrepancy against our published certificate, we refund the lot in full and pull it from sale pending investigation.
Tell us the lot number and what you observed. If independent testing shows a discrepancy against our published certificate, we refund the lot in full and pull it from sale pending investigation.
Certificate pending
Discreet packaging
Dispatched within one business day
Free US shipping, no minimum
Compound information
- Type
- Cellular & Redox
- Molecular weight
- 5358.2 g/mol
- Sequence
- ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (46 residues; lowercase marks D-configuration, as everywhere in this library)
- Form
- Lyophilized powder
- Vial strength
- 10mg
- Catalogue number
- PX-FOXO4-10MG
- Purity
- Certificate pending for this strength
Identifiers are published properties of the molecule. Values we cannot confirm are omitted rather than estimated.
Storage & handling
Lyophilized
Store lyophilized at -20C, protected from light and moisture. There is no cysteine and no methionine, so there is no thiol or thioether oxidation route. The practical concerns are instead charge-driven: fourteen basic residues give a strongly cationic molecule that adsorbs to anionic surfaces, and the same basicity means purified material carries a large counter-ion load. No published forced-degradation or solubility study exists for this peptide, so a working period has to be established in the laboratory.
Reconstituted
Once reconstituted, keep refrigerated and avoid repeated freeze-thaw cycles.
Safety & handling
Bench handling, not a dosing guide.
Intended use
Supplied strictly as a laboratory research material for in-vitro study by qualified researchers. Not for human or veterinary use, not for ingestion or injection, and not for any clinical or diagnostic application.
Personal protective equipment
Handle with gloves, eye protection and a laboratory coat. Weigh and transfer lyophilized powder in a ventilated enclosure to avoid generating an inhalable dust.
Reconstitution
Reconstitute against the diluent and volume appropriate to your protocol, adding solvent slowly down the vial wall rather than directly onto the pellet. Do not shake. This is a handling note, not a dosing guide.
Storage after opening
Once reconstituted, refrigerate and use within the period appropriate to the material. Avoid repeated freeze-thaw cycles, which degrade peptides faster than continuous storage at the listed temperature.
Disposal
Dispose of material and containers in accordance with your institution's chemical waste procedures and applicable local regulations.
Research notice
Supplied as a lyophilized powder for in-vitro laboratory research only. No statement on this page describes an application, benefit, dose, route or outcome. Descriptions are structural and mechanistic, and reference data such as CAS numbers and molecular formulas is published information about the compound itself, provided for identification. No measured result is shown for this strength because a certificate has not yet been published for its lot.

