Skip to content
PepXtidePepXtide

Research use only. This compound is supplied for in-vitro laboratory research by qualified researchers. It is not for human or veterinary consumption and has not been evaluated by the FDA.

Back to catalog
LL-37 5mg vial
Purity per lotLyophilized powderResearch use only

Matrix & Cytoskeletal

LL-37

Certificate pending · 5mg

5mg$90.00each

$18.00/mg

LL-37 is the thirty-seven-residue mature antimicrobial peptide released from human cathelicidin, the product of the CAMP gene. UniProt P49913 annotates it as residues 134 to 170 of the 170-residue precursor.

The name records the sequence: it begins with two leucines and runs thirty-seven residues to a C-terminal serine, carried as the free acid with a free N-terminal amine. There is no acetylation and no amidation. One distinction matters for anyone matching a mass against a label. FALL-39, the thirty-nine-residue species Agerberth and colleagues predicted in 1995, begins two residues earlier at Phe132; the peptide processed in granulocytes and described by Gudmundsson and colleagues in 1996 is the thirty-seven-residue form supplied here, and the two have different masses.

There is no cysteine in the sequence, which Agerberth and colleagues stated in their title, and the two disulfides recorded on UniProt P49913 at residues 86 to 97 and 108 to 125 belong to the cathelin-like propeptide rather than to this fragment. Carrying those bonds onto a specification for LL-37 is a common transcription error and they are absent here for that reason.

The molecule has four phenylalanines, at positions 5, 6, 17 and 27, and no tryptophan or tyrosine at all. Phenylalanine absorbs near 257 nm and contributes essentially nothing at 280 nm, so absorbance at 280 nm cannot be used to determine concentration here; amino-acid analysis, low-ultraviolet absorbance or quantitative NMR is required instead.

Structurally it is a curved amphipathic helix. Solution NMR in detergent micelles, deposited as PDB 2K6O by Wang in 2008, resolves a helix-bend-helix spanning residues 2 to 31 with the bend between Gly14 and Glu16 and a disordered C-terminal tail; those same four phenylalanine rings make the lipid contacts. A 1.9 Angstrom crystal structure from Sancho-Vaello and colleagues, PDB 5NNM, shows the dimer.

Its best-characterised molecular partner is not a protein but the anionic lipid bilayer itself. The clearest protein receptor in the literature is FPR2, the N-formyl peptide receptor 2 (UniProt P25090), a class A G-protein-coupled receptor; Yang and colleagues reported calcium mobilisation in receptor-transfected HEK293 cells in 2000. Other reported interactors rest on single reports and are not treated here as established.

Two things frequently quoted for this peptide are not supported by a primary source and are left out: a quantitative figure for adsorptive loss to glass or plastic, and any documented forced-degradation pathway. FDA GSRS also carries a molecular-formula text field for this substance that is chemically impossible, so the formula above is taken from PubChem CID 16198951, which agrees with the sequence.

Certificate pending for the 5mg lot.The signed report will be published here as soon as the laboratory returns it.

Ordering at volume or on a schedule?

Request a supply quote →

Buy more of this strength and the price comes down. The store applies it at checkout - there is nothing to enter.

Free US shipping - no minimum

Tell us the lot number and what you observed. If independent testing shows a discrepancy against our published certificate, we refund the lot in full and pull it from sale pending investigation.

1
$90.00each
Purchase type

Certificate pending

Discreet packaging

Dispatched within one business day

Free US shipping, no minimum

Compound information

Type
Matrix & Cytoskeletal
CAS number
154947-66-7
Molecular formula
C205H340N60O53
Molecular weight
4493.3 g/mol
Sequence
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser ([LL-37, 37 aa])
Form
Lyophilized powder
Vial strength
5mg
Catalogue number
PX-LL37-5MG
Purity
Certificate pending for this strength

Identifiers are published properties of the molecule. Values we cannot confirm are omitted rather than estimated.

Research overview

Human cathelicidin, all 37 residues

The complete human cathelicidin. Strongly cationic, with five lysines and five arginines, which is what lets it associate with membranes. One of the largest structures here, so it is drawn without hydrogens to stay readable.

Residues
37
Atoms
318

Primary literature

We have not compiled a reading list for this compound, and would rather show nothing than pad one out.

No public database record resolved for this compound under its catalogue name either. Rather than point you at a search that returns something else, this section stays empty.

PubMed, PubChem and ClinicalTrials.gov are independent scientific databases. A record or a published paper is not an endorsement of this product, and nothing indexed there describes an application, dose or outcome supported by PepXtide.

Storage & handling

Lyophilized

Store lyophilized at -20C, protected from light and moisture. There is no cysteine and no methionine, so there is no oxidation route through a side chain; the liabilities are instead physical. The peptide carries a net side-chain charge of about plus six, and its conformation is set by the solution it is in rather than fixed: circular dichroism work by Johansson and colleagues in 1998 found it disordered in plain water, helical in the presence of bicarbonate, sulfate or trifluoroacetate, disordered below pH 5 and fully unfolded at pH 2. Buffer choice is therefore not cosmetic here. Concentration-dependent self-association is documented in the same study, so prepare working solutions fresh and near neutral pH..

Reconstituted

Refrigerate after reconstitution and use within the period appropriate to the material.

Safety & handling

Bench handling, not a dosing guide.

Intended use

Supplied strictly as a laboratory research material for in-vitro study by qualified researchers. Not for human or veterinary use, not for ingestion or injection, and not for any clinical or diagnostic application.

Personal protective equipment

Handle with gloves, eye protection and a laboratory coat. Weigh and transfer lyophilized powder in a ventilated enclosure to avoid generating an inhalable dust.

Reconstitution

Reconstitute against the diluent and volume appropriate to your protocol, adding solvent slowly down the vial wall rather than directly onto the pellet. Do not shake. This is a handling note, not a dosing guide.

Storage after opening

Once reconstituted, refrigerate and use within the period appropriate to the material. Avoid repeated freeze-thaw cycles, which degrade peptides faster than continuous storage at the listed temperature.

Disposal

Dispose of material and containers in accordance with your institution's chemical waste procedures and applicable local regulations.

Research notice

Supplied as a lyophilized powder for in-vitro laboratory research only. No statement on this page describes an application, benefit, dose, route or outcome. Descriptions are structural and mechanistic, and reference data such as CAS numbers and molecular formulas is published information about the compound itself, provided for identification. No measured result is shown for this strength because a certificate has not yet been published for its lot.